(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0003

BA000037.VV0003      Location/Qualifiers
FT   CDS             complement(2314..3933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0003"
FT                   /product="inner membrane protein, 60 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92767"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92767"
FT                   /db_xref="GOA:Q7MQK5"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQK5"
FT                   /protein_id="BAC92767.1"
FT                   /translation="MDSQRTLLVLLLALVSFLLFQQWQVAKNPAPQAVEQAQTSSTLPA
FT                   PSFADELDPAPAQQASAKLITVTTDVLTLSIDTVGGDVVAADLNQYSAELNSANAFELL
FT                   RDTQGHQFIAQSGLVGPQGIDLSSNNRPSYQVSADSFTLADDQNELRIPMTYQANGLEY
FT                   TKTFILKRGSYAIDVEFDVINKSGNNATLGMYAHLRQNLMDAGGSITMPTYRGGAYSTE
FT                   DTRYKKYSFEDMQDRNLSLTLTNGQGWAAMIQHYFAAAWIPRNEPGANLYTRVIGNMGD
FT                   IGVRMPNKTVADGDSAHFTATLWAGPKLQDQMAEVAPNLDLVVDYGWLWFIAKPLHWLL
FT                   SVIQSFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDRQR
FT                   MSQEMMELYKKEKVNPLGGCLPLILQMPIFIALYWALMESVELRHSPFILWIHDLSAQD
FT                   PYFILPLLMGGSMFLIQKMSPTTVTDPMQQKIMTFMPVMFTFFFLWFPSGLVLYWLVSN
FT                   IVTLIQQSLIYKALEKKGLHTK"
     MDSQRTLLVL LLALVSFLLF QQWQVAKNPA PQAVEQAQTS STLPAPSFAD ELDPAPAQQA        60
     SAKLITVTTD VLTLSIDTVG GDVVAADLNQ YSAELNSANA FELLRDTQGH QFIAQSGLVG       120
     PQGIDLSSNN RPSYQVSADS FTLADDQNEL RIPMTYQANG LEYTKTFILK RGSYAIDVEF       180
     DVINKSGNNA TLGMYAHLRQ NLMDAGGSIT MPTYRGGAYS TEDTRYKKYS FEDMQDRNLS       240
     LTLTNGQGWA AMIQHYFAAA WIPRNEPGAN LYTRVIGNMG DIGVRMPNKT VADGDSAHFT       300
     ATLWAGPKLQ DQMAEVAPNL DLVVDYGWLW FIAKPLHWLL SVIQSFVGNW GVAIICLTFI       360
     VRGAMYPLTK AQYTSMAKMR MLQPKLQAMR ERIGDDRQRM SQEMMELYKK EKVNPLGGCL       420
     PLILQMPIFI ALYWALMESV ELRHSPFILW IHDLSAQDPY FILPLLMGGS MFLIQKMSPT       480
     TVTDPMQQKI MTFMPVMFTF FFLWFPSGLV LYWLVSNIVT LIQQSLIYKA LEKKGLHTK        539
//

If you have problems or comments...

PBIL Back to PBIL home page