(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0008

BA000037.VV0008      Location/Qualifiers
FT   CDS             6389..6661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0008"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92773"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92773"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQJ9"
FT                   /protein_id="BAC92773.1"
FT                   /translation="MVMSAPNHLIEICSTVPSARISARALLTSPCSFTPRSLFTNGHAL
FT                   AMVSNGSPANCSGKPVFLISSSADRRSITNASARPNATSCSMPVS"
     MVMSAPNHLI EICSTVPSAR ISARALLTSP CSFTPRSLFT NGHALAMVSN GSPANCSGKP        60
     VFLISSSADR RSITNASARP NATSCSMPVS                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page