(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0015

BA000037.VV0015      Location/Qualifiers
FT   CDS             13955..14389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0015"
FT                   /product="16 kDa heat shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92779"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92779"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQJ3"
FT                   /protein_id="BAC92779.1"
FT                   /translation="MRNVDFSPLYRNAIGFDRLFNLMEASAAKNSSGGYPPYNIEQKDE
FT                   HNYRITMAVAGFAEDQLDLTQNENMLIVKGERKAEEGKNYVYQGIAERDFERKFQLADY
FT                   VKVVGASMENGLLHIDLVREIPEAMQPRKIAIGGTKLLEN"
     MRNVDFSPLY RNAIGFDRLF NLMEASAAKN SSGGYPPYNI EQKDEHNYRI TMAVAGFAED        60
     QLDLTQNENM LIVKGERKAE EGKNYVYQGI AERDFERKFQ LADYVKVVGA SMENGLLHID       120
     LVREIPEAMQ PRKIAIGGTK LLEN                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page