(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0016

BA000037.VV0016      Location/Qualifiers
FT   CDS             15081..15242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0016"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92781"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92781"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQJ1"
FT                   /protein_id="BAC92781.1"
FT                   /translation="MKHKLILLNGDLQTFNELDFLIISELHEPIEKTILVATLALGLIH
FT                   RKIHVLHQ"
     MKHKLILLNG DLQTFNELDF LIISELHEPI EKTILVATLA LGLIHRKIHV LHQ               53
//

If you have problems or comments...

PBIL Back to PBIL home page