(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0020

BA000037.VV0020      Location/Qualifiers
FT   CDS             complement(18651..20732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0020"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92784"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92784"
FT                   /db_xref="GOA:Q7MQI8"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQI8"
FT                   /protein_id="BAC92784.1"
FT                   /translation="MAKEFLIELGTEELPPTQLRTLAEAFAANFEAELKGAELTHEGVK
FT                   WYAAPRRLALKVTALAEHQADKIVEKRGPAVSAAFDAEGNATKAAQGWARGCGITVDQA
FT                   ERMITDKGEWLLFKQEVKGQPTADIVVELAAKALAGLPIAKPMRWGNKTTQFIRPVKTL
FT                   TMLMGSDLIQGEILGVASDRVIRGHRFMGEREFTIESAEQYPAILEERGKVMADYEMRK
FT                   AIILADAQKAAAAIGGIADLEDDLVEEVTSLVEWPVVLTAKFEEEFLKVPAEALVYTMK
FT                   GDQKYFPVYTEDKQLLPNFIFVSNIESKEPRYVIEGNEKVVRPRLADAEFFFNTDRKSK
FT                   LIDRLPMLENAIFQQQLGTIKDKTDRITELAGYIAEQIGADVEKSKRAGLLAKCDLMTS
FT                   MVFEFTDTQGVMGMHYARHDGEAEEVALALNEQYMPRFAGDDLPSNGVSAAVAMADKLD
FT                   TIVGIFGIGQAPKGSDPFALRRASLGVLRIIVEYGYNLDLVDLVAKAKSLFAQQDGTSR
FT                   LTNDNVEQEVIEFMLGRFRAWYQDEGFSVDIIQAVLARRPTKPADFDQRVKAVSHFREL
FT                   EAAEALAAANKRVGNILAKFDGELAAEIDLALLQEDAEKVLAENVEVMTEALEPAFATG
FT                   NYQEALSKLADLREPVDAFFDNVMVMADDEALKTNRLTLLNNLRNLFLQIADISLLQK"
     MAKEFLIELG TEELPPTQLR TLAEAFAANF EAELKGAELT HEGVKWYAAP RRLALKVTAL        60
     AEHQADKIVE KRGPAVSAAF DAEGNATKAA QGWARGCGIT VDQAERMITD KGEWLLFKQE       120
     VKGQPTADIV VELAAKALAG LPIAKPMRWG NKTTQFIRPV KTLTMLMGSD LIQGEILGVA       180
     SDRVIRGHRF MGEREFTIES AEQYPAILEE RGKVMADYEM RKAIILADAQ KAAAAIGGIA       240
     DLEDDLVEEV TSLVEWPVVL TAKFEEEFLK VPAEALVYTM KGDQKYFPVY TEDKQLLPNF       300
     IFVSNIESKE PRYVIEGNEK VVRPRLADAE FFFNTDRKSK LIDRLPMLEN AIFQQQLGTI       360
     KDKTDRITEL AGYIAEQIGA DVEKSKRAGL LAKCDLMTSM VFEFTDTQGV MGMHYARHDG       420
     EAEEVALALN EQYMPRFAGD DLPSNGVSAA VAMADKLDTI VGIFGIGQAP KGSDPFALRR       480
     ASLGVLRIIV EYGYNLDLVD LVAKAKSLFA QQDGTSRLTN DNVEQEVIEF MLGRFRAWYQ       540
     DEGFSVDIIQ AVLARRPTKP ADFDQRVKAV SHFRELEAAE ALAAANKRVG NILAKFDGEL       600
     AAEIDLALLQ EDAEKVLAEN VEVMTEALEP AFATGNYQEA LSKLADLREP VDAFFDNVMV       660
     MADDEALKTN RLTLLNNLRN LFLQIADISL LQK                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page