(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0025

BA000037.VV0025      Location/Qualifiers
FT   CDS             23535..23720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92789"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92789"
FT                   /db_xref="GOA:Q7MQI3"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQI3"
FT                   /protein_id="BAC92789.1"
FT                   /translation="MLTALDRLTIYSVLCFISFCALVFRTPAETSLMPILGMSATIIGI
FT                   WIEMHRWSGASEEQEN"
     MLTALDRLTI YSVLCFISFC ALVFRTPAET SLMPILGMSA TIIGIWIEMH RWSGASEEQE        60
     N                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page