(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0045

BA000037.VV0045      Location/Qualifiers
FT   CDS             54385..55362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0045"
FT                   /product="peptide ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92809"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92809"
FT                   /db_xref="GOA:Q7MQG3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG3"
FT                   /protein_id="BAC92809.1"
FT                   /translation="MFSFLVKRLFQALIVMFVISLVAFAIQDNLGDPLRELVGQSVSEA
FT                   ERQALRDELGLNDPFITKYTRFIGAALQGDLGTSYFFKRPAVDVILDKLVATLELVFGA
FT                   TVLIIVFSIPLGVYSAIHPKSFFTKVVMAGSSIGISIPVFLTAIMLMYVFSIELQWLPS
FT                   YGRGETYNLLGWESGFFTIDGLKHLVLPCIALASIMLPLFIRLVRSEMLEVLSSEYIKF
FT                   AKAKGLALNKIYYQHALKNTMLPVLTVGGVQIGTMVAYTILTETVFQWPGTGFLFLEAI
FT                   NRVDTPLITAYVIFVGLIFVVTNTIVDLLYGLINPTVNLTGKGA"
     MFSFLVKRLF QALIVMFVIS LVAFAIQDNL GDPLRELVGQ SVSEAERQAL RDELGLNDPF        60
     ITKYTRFIGA ALQGDLGTSY FFKRPAVDVI LDKLVATLEL VFGATVLIIV FSIPLGVYSA       120
     IHPKSFFTKV VMAGSSIGIS IPVFLTAIML MYVFSIELQW LPSYGRGETY NLLGWESGFF       180
     TIDGLKHLVL PCIALASIML PLFIRLVRSE MLEVLSSEYI KFAKAKGLAL NKIYYQHALK       240
     NTMLPVLTVG GVQIGTMVAY TILTETVFQW PGTGFLFLEA INRVDTPLIT AYVIFVGLIF       300
     VVTNTIVDLL YGLINPTVNL TGKGA                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page