(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0048

BA000037.VV0048      Location/Qualifiers
FT   CDS             56490..57434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92812"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92812"
FT                   /db_xref="GOA:Q7MQG0"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG0"
FT                   /protein_id="BAC92812.1"
FT                   /translation="MELSKSARLPIFKPQRLWLMAALCFFGVATPAAAEGFLCEATQAS
FT                   TNELPMLDKACPIGDGVWGKKAPKSGKEDFFWIQCGILNQPMPLADAKPLYKQITTDVW
FT                   MKPENKTYRCLIGPYQSFAQASKDLKQVKKLGDYREAFIRVVKPHSAVKPVTASKEQKA
FT                   ITKPTAPKAQPKAPAAANKPMAAPAQATLATTPAKRSNDDSSSIDIRKSAELKGRTYAV
FT                   PYLMDDEHQFYMEHNQAWNRLDYGSAEVVCGDLHMRLLTEEEFFTLLDSKVMENQQWPM
FT                   QLPYWGRGKKGFFTDGRVTQVKGSSLLNVLCVK"
     MELSKSARLP IFKPQRLWLM AALCFFGVAT PAAAEGFLCE ATQASTNELP MLDKACPIGD        60
     GVWGKKAPKS GKEDFFWIQC GILNQPMPLA DAKPLYKQIT TDVWMKPENK TYRCLIGPYQ       120
     SFAQASKDLK QVKKLGDYRE AFIRVVKPHS AVKPVTASKE QKAITKPTAP KAQPKAPAAA       180
     NKPMAAPAQA TLATTPAKRS NDDSSSIDIR KSAELKGRTY AVPYLMDDEH QFYMEHNQAW       240
     NRLDYGSAEV VCGDLHMRLL TEEEFFTLLD SKVMENQQWP MQLPYWGRGK KGFFTDGRVT       300
     QVKGSSLLNV LCVK                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page