(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0050

BA000037.VV0050      Location/Qualifiers
FT   CDS             60471..61334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0050"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92814"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92814"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF8"
FT                   /protein_id="BAC92814.1"
FT                   /translation="MKQWARLITIGACLGSASAGAQATLDKSKYGYSYFTLGFENVVYE
FT                   ELFPGLDSDASVVSPVLNTGGLYHINTRFDFSIDALATFSPMSATEEWQKDGTLIQTNQ
FT                   FEYLKAATNILLHYKLQDNWRVLGGTSLTYQTYKRYGLKNHNGYVNDVFREGNTWEEKS
FT                   TDIFLDAGVAYDSGHLYGESDWRVSGRWIFGVPIWSVTENSRFEDIQFNDFGFRTNAEA
FT                   TLSYQIMPGLHLGWFVMLGYEKRFESDPQRVMYTTASGVEKQGQAWLPEAQTWTLNTGL
FT                   QALWNF"
     MKQWARLITI GACLGSASAG AQATLDKSKY GYSYFTLGFE NVVYEELFPG LDSDASVVSP        60
     VLNTGGLYHI NTRFDFSIDA LATFSPMSAT EEWQKDGTLI QTNQFEYLKA ATNILLHYKL       120
     QDNWRVLGGT SLTYQTYKRY GLKNHNGYVN DVFREGNTWE EKSTDIFLDA GVAYDSGHLY       180
     GESDWRVSGR WIFGVPIWSV TENSRFEDIQ FNDFGFRTNA EATLSYQIMP GLHLGWFVML       240
     GYEKRFESDP QRVMYTTASG VEKQGQAWLP EAQTWTLNTG LQALWNF                     287
//

If you have problems or comments...

PBIL Back to PBIL home page