(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0051

BA000037.VV0051      Location/Qualifiers
FT   CDS             complement(61356..62957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0051"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92815"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92815"
FT                   /db_xref="GOA:Q7MQF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF7"
FT                   /protein_id="BAC92815.1"
FT                   /translation="MAAITNGIIRIMTHRKPLFVVFAITFVTGMWFWLSSSQATSSVLS
FT                   EAETRVAAPHAKAISVESKVPNTATPTQNANLHVSPLFTQAAAILPSPPSEETGQTPTP
FT                   EEELEIALPSSASSTTVIVSDKELAKGVGANSKPRLNAEVARQIQSQIFGWELDQGAPI
FT                   HYALNIDQLFIDADDDFLTLTVRINVPGLKVRNLGTVQILGTATKAVAQPQLMIAARDD
FT                   HHGSDDQAWVKAYFDLPAIGETAAPFDHPLIGQTFYRLETTQTLAGIRYPYEVIYCQAW
FT                   KLINHQVYFAAARNRRQCPSDEELKLIGEFEQQDDKLILTSSQSAFDAKQTWMTRQSYP
FT                   SNLTEGLVNHLTTVHDGNQYETYTMVTDKAAMEARLNVETGRKLYEMTFFDYLFIDAEQ
FT                   NYLPAEVGNYIYERQAADPTVYQRFDSDLNIHRISGSFDCSTLLPYFELSVIAGRGDYE
FT                   DVISYSHNEDGVSSVACFVFPSGPNKRSLAINHDYRDDNDLQQGEIYSYILRPKPQFAH
FT                   LLEELKINLIYHHPQL"
     MAAITNGIIR IMTHRKPLFV VFAITFVTGM WFWLSSSQAT SSVLSEAETR VAAPHAKAIS        60
     VESKVPNTAT PTQNANLHVS PLFTQAAAIL PSPPSEETGQ TPTPEEELEI ALPSSASSTT       120
     VIVSDKELAK GVGANSKPRL NAEVARQIQS QIFGWELDQG APIHYALNID QLFIDADDDF       180
     LTLTVRINVP GLKVRNLGTV QILGTATKAV AQPQLMIAAR DDHHGSDDQA WVKAYFDLPA       240
     IGETAAPFDH PLIGQTFYRL ETTQTLAGIR YPYEVIYCQA WKLINHQVYF AAARNRRQCP       300
     SDEELKLIGE FEQQDDKLIL TSSQSAFDAK QTWMTRQSYP SNLTEGLVNH LTTVHDGNQY       360
     ETYTMVTDKA AMEARLNVET GRKLYEMTFF DYLFIDAEQN YLPAEVGNYI YERQAADPTV       420
     YQRFDSDLNI HRISGSFDCS TLLPYFELSV IAGRGDYEDV ISYSHNEDGV SSVACFVFPS       480
     GPNKRSLAIN HDYRDDNDLQ QGEIYSYILR PKPQFAHLLE ELKINLIYHH PQL              533
//

If you have problems or comments...

PBIL Back to PBIL home page