(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0054

BA000037.VV0054      Location/Qualifiers
FT   CDS             complement(64970..66304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92818"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92818"
FT                   /db_xref="GOA:Q7MQF4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF4"
FT                   /protein_id="BAC92818.1"
FT                   /translation="MQLGTSTTQVFYRLLDLNEEEKQQALQQLEQDAPEVYRALTPLMQ
FT                   PQESEPLTELLGFHAHHATDTSLDLAGQLIDKYQLTHELGRGGMGVVYAAYRADETFEQ
FT                   QLAIKFIQPSLTKVLGKKALFDEAQLLARLNHPCIAKVFDGGVYQDSVYIVMEQVDGVT
FT                   LDTYLKHHTLDQTAKLTLFLQLCQAVEHAHHNQVLHADLKPENILIDHAQRPKLLDFNL
FT                   TQKVSDQAKQQGKTGLVAFSEHYASPEQKSGGYLTQQSDLYSLGKILQLLFPHMKKRSD
FT                   LCFIAEKATQAIAEQRYLSVSELRVDIENMLACRPISLKQHIPLYTTKRLIQRRPMPTF
FT                   LLTLLVMTGVMFTSTLINKNRQLEQEKLIAEEMMYEVTRLMFHTKGNQLAQMSVSSMLE
FT                   ITRRRILSNPDIPKHIKQKMLLAMITPTPEKQVVEVDCQPNCQHP"
     MQLGTSTTQV FYRLLDLNEE EKQQALQQLE QDAPEVYRAL TPLMQPQESE PLTELLGFHA        60
     HHATDTSLDL AGQLIDKYQL THELGRGGMG VVYAAYRADE TFEQQLAIKF IQPSLTKVLG       120
     KKALFDEAQL LARLNHPCIA KVFDGGVYQD SVYIVMEQVD GVTLDTYLKH HTLDQTAKLT       180
     LFLQLCQAVE HAHHNQVLHA DLKPENILID HAQRPKLLDF NLTQKVSDQA KQQGKTGLVA       240
     FSEHYASPEQ KSGGYLTQQS DLYSLGKILQ LLFPHMKKRS DLCFIAEKAT QAIAEQRYLS       300
     VSELRVDIEN MLACRPISLK QHIPLYTTKR LIQRRPMPTF LLTLLVMTGV MFTSTLINKN       360
     RQLEQEKLIA EEMMYEVTRL MFHTKGNQLA QMSVSSMLEI TRRRILSNPD IPKHIKQKML       420
     LAMITPTPEK QVVEVDCQPN CQHP                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page