(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0058

BA000037.VV0058      Location/Qualifiers
FT   CDS             complement(69026..69286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0058"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92822"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92822"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF0"
FT                   /protein_id="BAC92822.1"
FT                   /translation="MFQRFTAQTGQQQLGTFLTNLKTRRIDTGQFRTNRLADIQGVVAH
FT                   NGQLLRHFNATLLRAQQGTDGDVIIGTKDPVHLWIRHQGTL"
     MFQRFTAQTG QQQLGTFLTN LKTRRIDTGQ FRTNRLADIQ GVVAHNGQLL RHFNATLLRA        60
     QQGTDGDVII GTKDPVHLWI RHQGTL                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page