(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0066

BA000037.VV0066      Location/Qualifiers
FT   CDS             complement(77024..77863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92830"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92830"
FT                   /db_xref="GOA:Q7MQE2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQE2"
FT                   /protein_id="BAC92830.1"
FT                   /translation="MLSYRHSFHAGNHADVVKHIVQSLILDSLKQKDKPFVYHDTHSGV
FT                   GRYDLTHEWSEKTGEYKQGVARIWDRSDLPADIASYIDSIKALNNGDKLRYYPGSPRVA
FT                   RAQLRDQDRMVLTELHPSDYPLLEQEFHRDRQVSIYKEDGFQRLKASLPPQERRGLVLI
FT                   DPPYELAKEYRDVVQAIYQSHKRWATGIYAIWYPVVNRCDIDDMLEGLEGLGIRKILQI
FT                   ELGVSPDTNERGMTASGMIVINPPWKLESQMQQILPFLKEAIAPATGHWKVEWIVPE"
     MLSYRHSFHA GNHADVVKHI VQSLILDSLK QKDKPFVYHD THSGVGRYDL THEWSEKTGE        60
     YKQGVARIWD RSDLPADIAS YIDSIKALNN GDKLRYYPGS PRVARAQLRD QDRMVLTELH       120
     PSDYPLLEQE FHRDRQVSIY KEDGFQRLKA SLPPQERRGL VLIDPPYELA KEYRDVVQAI       180
     YQSHKRWATG IYAIWYPVVN RCDIDDMLEG LEGLGIRKIL QIELGVSPDT NERGMTASGM       240
     IVINPPWKLE SQMQQILPFL KEAIAPATGH WKVEWIVPE                              279
//

If you have problems or comments...

PBIL Back to PBIL home page