(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0084

BA000037.VV0084      Location/Qualifiers
FT   CDS             96909..97124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0084"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92849"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92849"
FT                   /db_xref="GOA:Q7MQC3"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQC3"
FT                   /protein_id="BAC92849.1"
FT                   /translation="MMKFSIVHPIYPIAFPECGAIIGGIESIITICKMKKILTVLLTLS
FT                   VALLAGCGQSGALYIPDDAQQSEQSQ"
     MMKFSIVHPI YPIAFPECGA IIGGIESIIT ICKMKKILTV LLTLSVALLA GCGQSGALYI        60
     PDDAQQSEQS Q                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page