(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0091

BA000037.VV0091      Location/Qualifiers
FT   CDS             101773..104262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0091"
FT                   /product="GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92855"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92855"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQB7"
FT                   /protein_id="BAC92855.1"
FT                   /translation="MQTFSFWVEDLTQLQAMTADYRWDAHNTYLVQIFSTQTASITQGY
FT                   VRHLLAHLPNVDIIGHSTQHTIYGGEILTGGCLVVIAEFCHTTLTSAVVAYSGSADLDG
FT                   YDLCQALQLTPTSRAVISFSVQVERQDYPLYGAFNDGIATPVCGGLAQSGADGCWVLHQ
FT                   DQLYTQAAVAVALHSEQLKVWTSAYSEWNPVGMYHAVTAAEGQRLISLGNKPAYEVYKR
FT                   YLADGHELSASHLLNFPLYRERGKHKEVCAVREIHHDGSISFDKTWSIGDQVRFCYNHP
FT                   SLTLEQIKHGVVELALHQPETVFIYNCASRLDFIDGCQEVAPFHQITTSHGSYCMGELY
FT                   HDGLQQEILHHSLTYLAMRESDEVTELKLPADDVDSTISPLFCLIRNAIADLDQVQSRM
FT                   EYQLERQTLKLQESYRRDSRTGLQNRIALKEYLSAIRDDEHLLTLKLLNFSHINEKYGY
FT                   QVGDELLRMLSVSFLTRLRRRLGKQADMQLYSIGVGEWAFVFRAEICGETIKQQFTRFA
FT                   DVIEQTNFEPSGLEQVDYLSISLCGGLASRRDFPQASGDELLLKAIEARRAGVRSNTHI
FT                   CNAKDIQVSDERRKEQLAWLSCVSRAILQQNIVTYAQPLFHADGTTPYSQECLVRIVEN
FT                   DGRIILPGQFLPIIADTHLYTRLSRHMIQSTLNYMRERDGMFSINLSPQDLMSDKTMLL
FT                   LETAIRQLNDPSRIGLEVLESEQIKDYGRMIEVCSHFRQLGARIIVDDFGSGYSNIDEI
FT                   IKLEPDIIKLDGSLIRNIDQDSKQRKIASQLVRLCQVLEAKTVAEFVHNQQVCEIAQDM
FT                   GVDYLQGYYLGQPSRLF"
     MQTFSFWVED LTQLQAMTAD YRWDAHNTYL VQIFSTQTAS ITQGYVRHLL AHLPNVDIIG        60
     HSTQHTIYGG EILTGGCLVV IAEFCHTTLT SAVVAYSGSA DLDGYDLCQA LQLTPTSRAV       120
     ISFSVQVERQ DYPLYGAFND GIATPVCGGL AQSGADGCWV LHQDQLYTQA AVAVALHSEQ       180
     LKVWTSAYSE WNPVGMYHAV TAAEGQRLIS LGNKPAYEVY KRYLADGHEL SASHLLNFPL       240
     YRERGKHKEV CAVREIHHDG SISFDKTWSI GDQVRFCYNH PSLTLEQIKH GVVELALHQP       300
     ETVFIYNCAS RLDFIDGCQE VAPFHQITTS HGSYCMGELY HDGLQQEILH HSLTYLAMRE       360
     SDEVTELKLP ADDVDSTISP LFCLIRNAIA DLDQVQSRME YQLERQTLKL QESYRRDSRT       420
     GLQNRIALKE YLSAIRDDEH LLTLKLLNFS HINEKYGYQV GDELLRMLSV SFLTRLRRRL       480
     GKQADMQLYS IGVGEWAFVF RAEICGETIK QQFTRFADVI EQTNFEPSGL EQVDYLSISL       540
     CGGLASRRDF PQASGDELLL KAIEARRAGV RSNTHICNAK DIQVSDERRK EQLAWLSCVS       600
     RAILQQNIVT YAQPLFHADG TTPYSQECLV RIVENDGRII LPGQFLPIIA DTHLYTRLSR       660
     HMIQSTLNYM RERDGMFSIN LSPQDLMSDK TMLLLETAIR QLNDPSRIGL EVLESEQIKD       720
     YGRMIEVCSH FRQLGARIIV DDFGSGYSNI DEIIKLEPDI IKLDGSLIRN IDQDSKQRKI       780
     ASQLVRLCQV LEAKTVAEFV HNQQVCEIAQ DMGVDYLQGY YLGQPSRLF                   829
//

If you have problems or comments...

PBIL Back to PBIL home page