(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0093

BA000037.VV0093      Location/Qualifiers
FT   CDS             complement(104914..106464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0093"
FT                   /product="predicted membrane protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92857"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92857"
FT                   /db_xref="InterPro:IPR014540"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQB5"
FT                   /protein_id="BAC92857.1"
FT                   /translation="MKAFKNPVALSTLLLLQACSTSAPVATQSAPVLPTANLSQPESVV
FT                   AQSFMLSGSLVVGHEAQYITPCGSTQQYWLQLSAQQRQQLMALTSLPYQSMYGEVIGHL
FT                   KTTGDEGFASEYDALFVVEQLNLVDASNPTRCEQAARPTQAFGNEPNWRIDFAANQLTI
FT                   KQLSKQEQTRVISRSQLSPRKREYQFDDGQLLLTENLCKDTMSNSLYGWKATLDWQDTQ
FT                   LSGCATTSNIDATLGWGGLYTATSTQSSGFSVHMQLNADHSAETRYLYANEERPLVEKG
FT                   YWQQLNPNQIQVVMTHHQGQKLVTERIFTRTGSQLKADKEKVGKVVYPIAQGGLILYPA
FT                   AAGEMMSDAPITTQTAVPTDTRNVTSSAEFRRDVDQAIREYFRLHKTDPSNNQYRWLTY
FT                   DLNGDGKEELLAQLDWCGSGGCTLLIFENHQETWRFNSRITLVNTPIYLGNQRNHGWQD
FT                   LIFNVSGGGAKAQSHLMQYDGISYPLNPSVAPVALGEQISPVELFADGISPAREGVKL"
     MKAFKNPVAL STLLLLQACS TSAPVATQSA PVLPTANLSQ PESVVAQSFM LSGSLVVGHE        60
     AQYITPCGST QQYWLQLSAQ QRQQLMALTS LPYQSMYGEV IGHLKTTGDE GFASEYDALF       120
     VVEQLNLVDA SNPTRCEQAA RPTQAFGNEP NWRIDFAANQ LTIKQLSKQE QTRVISRSQL       180
     SPRKREYQFD DGQLLLTENL CKDTMSNSLY GWKATLDWQD TQLSGCATTS NIDATLGWGG       240
     LYTATSTQSS GFSVHMQLNA DHSAETRYLY ANEERPLVEK GYWQQLNPNQ IQVVMTHHQG       300
     QKLVTERIFT RTGSQLKADK EKVGKVVYPI AQGGLILYPA AAGEMMSDAP ITTQTAVPTD       360
     TRNVTSSAEF RRDVDQAIRE YFRLHKTDPS NNQYRWLTYD LNGDGKEELL AQLDWCGSGG       420
     CTLLIFENHQ ETWRFNSRIT LVNTPIYLGN QRNHGWQDLI FNVSGGGAKA QSHLMQYDGI       480
     SYPLNPSVAP VALGEQISPV ELFADGISPA REGVKL                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page