(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0094

BA000037.VV0094      Location/Qualifiers
FT   CDS             106494..106976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92858"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92858"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQB4"
FT                   /protein_id="BAC92858.1"
FT                   /translation="MDRIMAYWLFKTEPDTFSIDTLRVQKVSCWEGVRNYQARNMLRDE
FT                   VKEGDWVMIYHSSCKQVGVAGIAKVVREAYPDHFQFDANSDYYDAKSTPENPRWIMVDV
FT                   EFVRKTERVIPLAVLKAMPELENMPLVKKGNRLSVMPVTEQEWQAILTKEKLPSRR"
     MDRIMAYWLF KTEPDTFSID TLRVQKVSCW EGVRNYQARN MLRDEVKEGD WVMIYHSSCK        60
     QVGVAGIAKV VREAYPDHFQ FDANSDYYDA KSTPENPRWI MVDVEFVRKT ERVIPLAVLK       120
     AMPELENMPL VKKGNRLSVM PVTEQEWQAI LTKEKLPSRR                             160
//

If you have problems or comments...

PBIL Back to PBIL home page