(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0098

BA000037.VV0098      Location/Qualifiers
FT   CDS             109818..111041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0098"
FT                   /product="predicted signal transduction protein"
FT                   /note="containing EAL and modified HD-GYP domains"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92862"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92862"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQB0"
FT                   /protein_id="BAC92862.1"
FT                   /translation="MNTTYVARQPIFNRKKHTLGYELLFRDGESNAYPVHIESNRATYR
FT                   LIVENFLSVGTNPAIASSRCFINFPYQTLIRRLPLSLPKNKVVIEVLETCQPTDELLDA
FT                   IRDLYREGYVIALDDFTLTPEWRRFLPYVHIVKLDVMDLGMEKACELVKEHLARRVKYH
FT                   FLAEKVETAEEFELAKEAGFKFFQGYFFSKPEVVQTRYVSPEQTVALELFREVCKSEPD
FT                   FGRIEQIISQDVALSYKLLRFVNTQSTRLEVTISSFRQALIYLGQDKLKMFVSLVVASY
FT                   VSTNKPRELYNLSLQRAQFCELMSRRHPFSKHNEQGFMIGLLSILDAMMDLSVESLVNH
FT                   LPLSEIAKQALLCRGGAYGALIALEECFEQADWRGIEQWCEQLGLSIEEVRYELVEAQR
FT                   WSQEFALI"
     MNTTYVARQP IFNRKKHTLG YELLFRDGES NAYPVHIESN RATYRLIVEN FLSVGTNPAI        60
     ASSRCFINFP YQTLIRRLPL SLPKNKVVIE VLETCQPTDE LLDAIRDLYR EGYVIALDDF       120
     TLTPEWRRFL PYVHIVKLDV MDLGMEKACE LVKEHLARRV KYHFLAEKVE TAEEFELAKE       180
     AGFKFFQGYF FSKPEVVQTR YVSPEQTVAL ELFREVCKSE PDFGRIEQII SQDVALSYKL       240
     LRFVNTQSTR LEVTISSFRQ ALIYLGQDKL KMFVSLVVAS YVSTNKPREL YNLSLQRAQF       300
     CELMSRRHPF SKHNEQGFMI GLLSILDAMM DLSVESLVNH LPLSEIAKQA LLCRGGAYGA       360
     LIALEECFEQ ADWRGIEQWC EQLGLSIEEV RYELVEAQRW SQEFALI                     407
//

If you have problems or comments...

PBIL Back to PBIL home page