(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0101

BA000037.VV0101      Location/Qualifiers
FT   CDS             112514..113023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0101"
FT                   /product="predicted protein-tyrosine phosphatase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92865"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92865"
FT                   /db_xref="GOA:Q7MQA7"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR022778"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA7"
FT                   /protein_id="BAC92865.1"
FT                   /translation="METSITNHPVWQLDLPSGALVLTPCPGTKGVDLRSSLQQLADIGV
FT                   QAVVTALGDAELASKEVAELGPLVVELGMRWYQIEIEDDCAPDETFAVHWQQASPELQA
FT                   ILRDGGKVALHCMGGSGRTGLFAAHLLLEQGWALDDIIREVQALRPGAFTREVQLSYIE
FT                   SVANAQ"
     METSITNHPV WQLDLPSGAL VLTPCPGTKG VDLRSSLQQL ADIGVQAVVT ALGDAELASK        60
     EVAELGPLVV ELGMRWYQIE IEDDCAPDET FAVHWQQASP ELQAILRDGG KVALHCMGGS       120
     GRTGLFAAHL LLEQGWALDD IIREVQALRP GAFTREVQLS YIESVANAQ                   169
//

If you have problems or comments...

PBIL Back to PBIL home page