(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0105

BA000037.VV0105      Location/Qualifiers
FT   CDS             115950..116351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92869"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92869"
FT                   /db_xref="GOA:Q7MQA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA3"
FT                   /protein_id="BAC92869.1"
FT                   /translation="MKQTLERKEGTMSEIEQVVTRTRRLETLLRTQYHAEGKGLHQLVT
FT                   SCEERLPHDVIGKLRFIATVRNKVVHEDNYQLDDKQRFLAACDECEKELTPRSGRFIWR
FT                   VAILLMLSMTLGAMAFYYANWDVLSQHFK"
     MKQTLERKEG TMSEIEQVVT RTRRLETLLR TQYHAEGKGL HQLVTSCEER LPHDVIGKLR        60
     FIATVRNKVV HEDNYQLDDK QRFLAACDEC EKELTPRSGR FIWRVAILLM LSMTLGAMAF       120
     YYANWDVLSQ HFK                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page