(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0114

BA000037.VV0114      Location/Qualifiers
FT   CDS             122108..123076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0114"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92878"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92878"
FT                   /db_xref="GOA:Q7MQ94"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ94"
FT                   /protein_id="BAC92878.1"
FT                   /translation="MAANKRLKKPASKSTSNRPKTDGFVSIHIKQAKASFKAIWHRPLG
FT                   NILTLAVISMALAMPACLYLLGKNIAVATSHVTSPAQVSAYLREGVPEARVMVLKDELE
FT                   TQQDVELVEYISPQQGLEHLSQYSGFDQALSLLEDYALPGVLVITPAVEENNAIKALAQ
FT                   QLRQEEDITDVRLDEDWLTRLDAIKTVATIIVMTLTLLMLGAVFLIVGNTLRFNVLANK
FT                   EEIQTMKLIGATDNFILRPYLYSGMWFGLLGAVSAWCFTALITVLLNGAVADLAALYDS
FT                   QFRLIGLSWDESLLLVMTGTFLGCVAAKVSAQRHLKEIEPV"
     MAANKRLKKP ASKSTSNRPK TDGFVSIHIK QAKASFKAIW HRPLGNILTL AVISMALAMP        60
     ACLYLLGKNI AVATSHVTSP AQVSAYLREG VPEARVMVLK DELETQQDVE LVEYISPQQG       120
     LEHLSQYSGF DQALSLLEDY ALPGVLVITP AVEENNAIKA LAQQLRQEED ITDVRLDEDW       180
     LTRLDAIKTV ATIIVMTLTL LMLGAVFLIV GNTLRFNVLA NKEEIQTMKL IGATDNFILR       240
     PYLYSGMWFG LLGAVSAWCF TALITVLLNG AVADLAALYD SQFRLIGLSW DESLLLVMTG       300
     TFLGCVAAKV SAQRHLKEIE PV                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page