(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0128

BA000037.VV0128      Location/Qualifiers
FT   CDS             134779..135159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92892"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92892"
FT                   /db_xref="GOA:Q7MQ80"
FT                   /db_xref="InterPro:IPR009867"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ80"
FT                   /protein_id="BAC92892.1"
FT                   /translation="MSNDTENNVNRSSERKTLVLALITGMCGDAILSWLTMSEVSFSIF
FT                   PIIALVLAVQALYREYLNHPVSEEIPLVGLACFFVGAFGHSAFIKAQHPEAGSNFFAIM
FT                   VVLLLLAWIGSKLGYIRRPSAD"
     MSNDTENNVN RSSERKTLVL ALITGMCGDA ILSWLTMSEV SFSIFPIIAL VLAVQALYRE        60
     YLNHPVSEEI PLVGLACFFV GAFGHSAFIK AQHPEAGSNF FAIMVVLLLL AWIGSKLGYI       120
     RRPSAD                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page