(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0136

BA000037.VV0136      Location/Qualifiers
FT   CDS             complement(146363..147403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0136"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92900"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92900"
FT                   /db_xref="GOA:Q7MQ72"
FT                   /db_xref="InterPro:IPR022604"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ72"
FT                   /protein_id="BAC92900.1"
FT                   /translation="MRDYKICGSGHGVISAMYHSAANPIIRVAVFPVLLLFWQYVYGTD
FT                   LPLLAPAMCAVFLTTTHEPPPVIMVFVMGGILFITAWFQALMSELLIDYVHVYYLFLFG
FT                   IFYWCMERTKKNPQDVFAILLIVSTAMIAVFTQQKGISVEQIPMALLKNIFIAGFTAYL
FT                   AYLLFPRGEPLAISMPPVNSTTKYLLDWQTLLKASIVMTMMVCTIQLDLEQSTIITIIV
FT                   ALMIKDPDPSIGKDYGLRRLLTTYASVLYAIPPLIMSLLQVNLVGTVGVAVISALFMGI
FT                   HAVTKKASYNSIQLMYSSYVVLVFYGITSTSISAISDDLVRFTSVFAAVLIGIMSLITL
FT                   YPRTRT"
     MRDYKICGSG HGVISAMYHS AANPIIRVAV FPVLLLFWQY VYGTDLPLLA PAMCAVFLTT        60
     THEPPPVIMV FVMGGILFIT AWFQALMSEL LIDYVHVYYL FLFGIFYWCM ERTKKNPQDV       120
     FAILLIVSTA MIAVFTQQKG ISVEQIPMAL LKNIFIAGFT AYLAYLLFPR GEPLAISMPP       180
     VNSTTKYLLD WQTLLKASIV MTMMVCTIQL DLEQSTIITI IVALMIKDPD PSIGKDYGLR       240
     RLLTTYASVL YAIPPLIMSL LQVNLVGTVG VAVISALFMG IHAVTKKASY NSIQLMYSSY       300
     VVLVFYGITS TSISAISDDL VRFTSVFAAV LIGIMSLITL YPRTRT                      346
//

If you have problems or comments...

PBIL Back to PBIL home page