(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0141

BA000037.VV0141      Location/Qualifiers
FT   CDS             151234..153030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0141"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92905"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92905"
FT                   /db_xref="GOA:Q7MQ67"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ67"
FT                   /protein_id="BAC92905.1"
FT                   /translation="MNYKYSQKFNVMEALIALAIGITLSFFFSFKTQNSLLEATESSIV
FT                   AHSASLVHMRSYIHLTQREDGDHKINKLLSEIQKLTSELNTLKEASNDINVRFPQMIWV
FT                   GNPLPSVVEEYVKTADKQLVFLDKMLKAKQQIVPEVSLIELERQVFSEEMDEAAEHVHE
FT                   RLMDNIFLTSKAAVYTLILFIILIFSAVFLYLNHYIIELKKTKLALQVAVNKAEEANLA
FT                   KSMFLATMSHEIRTPMNGVIGMTQLLISDNKDPSIQTHLDTLLESGEHLMVVINEILDF
FT                   SNLEQGSLVFVQEEFELSKLLVPIKNSFQPQASEKKLQLIFDTNSLPEDLILVGDKTRI
FT                   RQVIYNLVGNAIKFTSDGQVKVVLKYESDKNELCIQVSDTGIGIPSHRLKGIFNAFEQA
FT                   DVRTMHDFGGTGLGLSIVKKICLSMGGDITVTSELGSGSCFVAKVISPRVTTLRDQRTL
FT                   SGEKDFSGKSVLIVEDNRVNQLVAQRLCQKLGFTTYIASNGIEAVKRVRECSFDVILMD
FT                   HQMPQMGGIEATKLIRNEHAFQGIILGCTADVTKDTAIAFVDAGANGVITKPLQLDSLG
FT                   ELIARSVTLACNASRDHHVVLE"
     MNYKYSQKFN VMEALIALAI GITLSFFFSF KTQNSLLEAT ESSIVAHSAS LVHMRSYIHL        60
     TQREDGDHKI NKLLSEIQKL TSELNTLKEA SNDINVRFPQ MIWVGNPLPS VVEEYVKTAD       120
     KQLVFLDKML KAKQQIVPEV SLIELERQVF SEEMDEAAEH VHERLMDNIF LTSKAAVYTL       180
     ILFIILIFSA VFLYLNHYII ELKKTKLALQ VAVNKAEEAN LAKSMFLATM SHEIRTPMNG       240
     VIGMTQLLIS DNKDPSIQTH LDTLLESGEH LMVVINEILD FSNLEQGSLV FVQEEFELSK       300
     LLVPIKNSFQ PQASEKKLQL IFDTNSLPED LILVGDKTRI RQVIYNLVGN AIKFTSDGQV       360
     KVVLKYESDK NELCIQVSDT GIGIPSHRLK GIFNAFEQAD VRTMHDFGGT GLGLSIVKKI       420
     CLSMGGDITV TSELGSGSCF VAKVISPRVT TLRDQRTLSG EKDFSGKSVL IVEDNRVNQL       480
     VAQRLCQKLG FTTYIASNGI EAVKRVRECS FDVILMDHQM PQMGGIEATK LIRNEHAFQG       540
     IILGCTADVT KDTAIAFVDA GANGVITKPL QLDSLGELIA RSVTLACNAS RDHHVVLE         598
//

If you have problems or comments...

PBIL Back to PBIL home page