(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0144

BA000037.VV0144      Location/Qualifiers
FT   CDS             154392..155774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92908"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92908"
FT                   /db_xref="GOA:Q7MQ64"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ64"
FT                   /protein_id="BAC92908.1"
FT                   /translation="MLRLWQEECVGSALEKYLAGHSHFQVQATPGAGKTVAAAEIAKRL
FT                   YDLDKIDLVLCFSPSLTIADGIKNTFSWRLGCSFSGGLGSIGASFTYQSMKYLRDSFWE
FT                   TIKKHRVLVVFDEIHHCSGDEIENANVWGEQILRQIQGIAAFTLSLSGTPWRSDLLPIT
FT                   LAQYSDAEGRIHCDYQYGLKQAIIDKVCRSPKIVLIDNDRLSISESGQSKSFSSIPDLL
FT                   KQSATPYQSILQNIDAMTYVLGLGCKKLADIRMDNPNAGGLVVASSVGHAIEIQKVLTE
FT                   TYEQSTEIVTYYHENPLEKINGYRNGTTQWIISVGMISEGTDIPRLQVCCHLSFVKTEL
FT                   YFRQVLGRILRTHESSNQQAWLYTFAEESLVSFAEQIEQDIPDSCLFIKPDNWQDRPQA
FT                   SVSLNRAYFSDQQKKKTDIGKTQLSWDKERLEKPSIITAYSASSGQLNLGNFRERVIAA
FT                   FQ"
     MLRLWQEECV GSALEKYLAG HSHFQVQATP GAGKTVAAAE IAKRLYDLDK IDLVLCFSPS        60
     LTIADGIKNT FSWRLGCSFS GGLGSIGASF TYQSMKYLRD SFWETIKKHR VLVVFDEIHH       120
     CSGDEIENAN VWGEQILRQI QGIAAFTLSL SGTPWRSDLL PITLAQYSDA EGRIHCDYQY       180
     GLKQAIIDKV CRSPKIVLID NDRLSISESG QSKSFSSIPD LLKQSATPYQ SILQNIDAMT       240
     YVLGLGCKKL ADIRMDNPNA GGLVVASSVG HAIEIQKVLT ETYEQSTEIV TYYHENPLEK       300
     INGYRNGTTQ WIISVGMISE GTDIPRLQVC CHLSFVKTEL YFRQVLGRIL RTHESSNQQA       360
     WLYTFAEESL VSFAEQIEQD IPDSCLFIKP DNWQDRPQAS VSLNRAYFSD QQKKKTDIGK       420
     TQLSWDKERL EKPSIITAYS ASSGQLNLGN FRERVIAAFQ                             460
//

If you have problems or comments...

PBIL Back to PBIL home page