(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0145

BA000037.VV0145      Location/Qualifiers
FT   CDS             155818..156123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0145"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92909"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ63"
FT                   /protein_id="BAC92909.1"
FT                   /translation="MFYIGVSHYYATGEGLTMYVASGSEESIRAAIPEYFHLGLTILTP
FT                   SEWLKAAAGDCEDEYHQSEAEDLKAYLPLLWKQIEERALERGCHLDFFMKHHFNYA"
     MFYIGVSHYY ATGEGLTMYV ASGSEESIRA AIPEYFHLGL TILTPSEWLK AAAGDCEDEY        60
     HQSEAEDLKA YLPLLWKQIE ERALERGCHL DFFMKHHFNY A                           101
//

If you have problems or comments...

PBIL Back to PBIL home page