(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0150

BA000037.VV0150      Location/Qualifiers
FT   CDS             complement(159261..159428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0150"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92914"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92914"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ58"
FT                   /protein_id="BAC92914.1"
FT                   /translation="MKVYLDDERPTPEGWHRVYWPEEAIAILKQGHVTEISLDHDLGND
FT                   EHGTGYDVVL"
     MKVYLDDERP TPEGWHRVYW PEEAIAILKQ GHVTEISLDH DLGNDEHGTG YDVVL             55
//

If you have problems or comments...

PBIL Back to PBIL home page