(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0154

BA000037.VV0154      Location/Qualifiers
FT   CDS             161096..161881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0154"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92918"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92918"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ54"
FT                   /protein_id="BAC92918.1"
FT                   /translation="MKLKTIILIIGFLSSPSIAFANENKVDVYDLVSTSSNVPTLDTVK
FT                   LITADGVLNKELKEFMLKKHNKQVLKDKKIAILATDGVEELEILVPLNYLREVGANVTI
FT                   VAPRKKIYPETLGLKIPENRRTHIMTVRLMENSGWLKIDKYIDEVSFDDFDGLVLPGGA
FT                   WNPDFLRTDVEAQNLVREIVNSNKPLATICHGPLVLINSGLVKDRKITGYWAIMKDLEN
FT                   AGAKVYDQPVVIDGNLISSRFPYDLPRLMNSFTEKLLNN"
     MKLKTIILII GFLSSPSIAF ANENKVDVYD LVSTSSNVPT LDTVKLITAD GVLNKELKEF        60
     MLKKHNKQVL KDKKIAILAT DGVEELEILV PLNYLREVGA NVTIVAPRKK IYPETLGLKI       120
     PENRRTHIMT VRLMENSGWL KIDKYIDEVS FDDFDGLVLP GGAWNPDFLR TDVEAQNLVR       180
     EIVNSNKPLA TICHGPLVLI NSGLVKDRKI TGYWAIMKDL ENAGAKVYDQ PVVIDGNLIS       240
     SRFPYDLPRL MNSFTEKLLN N                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page