(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0156

BA000037.VV0156      Location/Qualifiers
FT   CDS             162757..163041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92920"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92920"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ52"
FT                   /protein_id="BAC92920.1"
FT                   /translation="MINLTAAFHAKPEHTSTLKQALEAMLVPTRNEKGCVRYQLFQDKN
FT                   DICQFLFQEQFADQAAFDQHCNTEHFQALLSTIDGLLVSEPQITFFEEL"
     MINLTAAFHA KPEHTSTLKQ ALEAMLVPTR NEKGCVRYQL FQDKNDICQF LFQEQFADQA        60
     AFDQHCNTEH FQALLSTIDG LLVSEPQITF FEEL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page