(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0160

BA000037.VV0160      Location/Qualifiers
FT   CDS             complement(167166..167717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92924"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92924"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ48"
FT                   /protein_id="BAC92924.1"
FT                   /translation="MRYSFISTLILTIFSLSANATTNKHIIGTNIGYGGVNYGAPTSEE
FT                   SGDMFLGEIYYRYMTMHNFGIEAGYKGAIDGIGSAIVNQISQISDASFSGLRLSGYGSY
FT                   PLSSGFELYGKAGVTYYTLEYTYKVNDQTKNIDHATIGGEVAGGIGWSYRYFGLNVEYV
FT                   YSKNSDFDSSGLMFGAQFRF"
     MRYSFISTLI LTIFSLSANA TTNKHIIGTN IGYGGVNYGA PTSEESGDMF LGEIYYRYMT        60
     MHNFGIEAGY KGAIDGIGSA IVNQISQISD ASFSGLRLSG YGSYPLSSGF ELYGKAGVTY       120
     YTLEYTYKVN DQTKNIDHAT IGGEVAGGIG WSYRYFGLNV EYVYSKNSDF DSSGLMFGAQ       180
     FRF                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page