(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0163

BA000037.VV0163      Location/Qualifiers
FT   CDS             169425..170546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92927"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92927"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ45"
FT                   /protein_id="BAC92927.1"
FT                   /translation="MICLRSSKKTPKRDLDDIFPEDDDLGLLDVAPLKAKAPAGNLIAS
FT                   QFEEITTFFEKNGRIPASDADSFDEKRLARRLKAFKSNGEKRESLKEFDSYGLLADESS
FT                   YIPSIESVGSSTYEVQESTPSSEIDKSELVTSLDDIFDDDDDLLEFDAPDIFTIRHELK
FT                   IQVGDFFILNGLMGYVHSAGERLEGYSSYNARLHLVFENGTELHMLFQSLTHGLVRDDH
FT                   GCKVNREGVLLEPDSNPVPTGLVYVLATKSSDSVLATYKANLYKIGFTEGSVEDRIKHA
FT                   EKDRTFLEAPVRVVMTTECYNIDAHKLETLVHGFLGYQRLNITLKGHDGQGYKPREWFN
FT                   VPLATVVEVIKHILDGTISQYRMDNTSGKVMKK"
     MICLRSSKKT PKRDLDDIFP EDDDLGLLDV APLKAKAPAG NLIASQFEEI TTFFEKNGRI        60
     PASDADSFDE KRLARRLKAF KSNGEKRESL KEFDSYGLLA DESSYIPSIE SVGSSTYEVQ       120
     ESTPSSEIDK SELVTSLDDI FDDDDDLLEF DAPDIFTIRH ELKIQVGDFF ILNGLMGYVH       180
     SAGERLEGYS SYNARLHLVF ENGTELHMLF QSLTHGLVRD DHGCKVNREG VLLEPDSNPV       240
     PTGLVYVLAT KSSDSVLATY KANLYKIGFT EGSVEDRIKH AEKDRTFLEA PVRVVMTTEC       300
     YNIDAHKLET LVHGFLGYQR LNITLKGHDG QGYKPREWFN VPLATVVEVI KHILDGTISQ       360
     YRMDNTSGKV MKK                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page