(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0164

BA000037.VV0164      Location/Qualifiers
FT   CDS             170672..171766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92928"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92928"
FT                   /db_xref="GOA:Q7MQ44"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ44"
FT                   /protein_id="BAC92928.1"
FT                   /translation="MAITIHRAVVHELIKEKNEEPQPLHYRQSLLPVDNESVQNVIAGV
FT                   VNIYGRKNNSARYGVFRDDEASGSVPDSFYEYSELEDVSDEDFMVLSKSVMQELFREAT
FT                   GVAFATGGHILFSDYESDGVRFYLAAMIKQKSGFAFSDTLGVEDLEYIDLSKLHQAIKI
FT                   NFSKYNAYQNTDDIERQDSTYLSFVSPQTSQSAAGYFIQAMGCKAGAPSAKATQAAVDE
FT                   SVGFFESKEDLKAHAPNLKRALTVYLEQKAESNEPATLPDIEGIARRFFPTDDEEQADR
FT                   YADEFVTYLNREESGVPPEFPVNKTKLKTMTHLVYKGDDLHLEFDKEDIGGNPSARVYF
FT                   DGAKVIIKDLPQDLIDKLNQQING"
     MAITIHRAVV HELIKEKNEE PQPLHYRQSL LPVDNESVQN VIAGVVNIYG RKNNSARYGV        60
     FRDDEASGSV PDSFYEYSEL EDVSDEDFMV LSKSVMQELF REATGVAFAT GGHILFSDYE       120
     SDGVRFYLAA MIKQKSGFAF SDTLGVEDLE YIDLSKLHQA IKINFSKYNA YQNTDDIERQ       180
     DSTYLSFVSP QTSQSAAGYF IQAMGCKAGA PSAKATQAAV DESVGFFESK EDLKAHAPNL       240
     KRALTVYLEQ KAESNEPATL PDIEGIARRF FPTDDEEQAD RYADEFVTYL NREESGVPPE       300
     FPVNKTKLKT MTHLVYKGDD LHLEFDKEDI GGNPSARVYF DGAKVIIKDL PQDLIDKLNQ       360
     QING                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page