(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0176

BA000037.VV0176      Location/Qualifiers
FT   CDS             186807..188429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92940"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92940"
FT                   /db_xref="GOA:Q7MQ34"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ34"
FT                   /protein_id="BAC92940.1"
FT                   /translation="MKHASLFLERLIMQWIIDNQASLLLTLFSSLSTAILAAWWQRQKL
FT                   EVVNQLLQQQLESERRLSASKIEQLQHGMQQLQTELDDYDQERDQAAYEVKQTHGKLMA
FT                   AIEKLRYFDAVKQERQQYFDELTALRECNAKLETQLREQQARHEQLTQANQEKLQILEQ
FT                   AEVRLKQQFEHLANQLFEEKTAKVDQQNRLSLEGLLSPLKEQLEGFKKQVNDSFSHEAK
FT                   ERHTLVHELKNLQRLNEQMTREAVNLTQALKGDNKQQGNWGEVVLARVLAESGLREGHE
FT                   YQTQVSLQNEAGKRYQPDVIVYLPQDKQVVIDSKMTLVAYERYFHAESDSERAIELSNH
FT                   LAAIRAHIKGLSIKDYHQLKGIHSLDYVLMFIPVEPAFQLAIQADPSLVKDAMEQNIIL
FT                   VSPTTLLVALRTIDNLWRNERQSQNAKIIAQRASKLYDKLRLFVDDMQNLGGALDKANQ
FT                   SYQGAMNKLVTGRGNVIRQAESFKELGVEVKRPISTDLTQLAQNDSLVERHPVEDKVNY
FT                   STAVLGQENHFGPQSNRTAQEEK"
     MKHASLFLER LIMQWIIDNQ ASLLLTLFSS LSTAILAAWW QRQKLEVVNQ LLQQQLESER        60
     RLSASKIEQL QHGMQQLQTE LDDYDQERDQ AAYEVKQTHG KLMAAIEKLR YFDAVKQERQ       120
     QYFDELTALR ECNAKLETQL REQQARHEQL TQANQEKLQI LEQAEVRLKQ QFEHLANQLF       180
     EEKTAKVDQQ NRLSLEGLLS PLKEQLEGFK KQVNDSFSHE AKERHTLVHE LKNLQRLNEQ       240
     MTREAVNLTQ ALKGDNKQQG NWGEVVLARV LAESGLREGH EYQTQVSLQN EAGKRYQPDV       300
     IVYLPQDKQV VIDSKMTLVA YERYFHAESD SERAIELSNH LAAIRAHIKG LSIKDYHQLK       360
     GIHSLDYVLM FIPVEPAFQL AIQADPSLVK DAMEQNIILV SPTTLLVALR TIDNLWRNER       420
     QSQNAKIIAQ RASKLYDKLR LFVDDMQNLG GALDKANQSY QGAMNKLVTG RGNVIRQAES       480
     FKELGVEVKR PISTDLTQLA QNDSLVERHP VEDKVNYSTA VLGQENHFGP QSNRTAQEEK       540
//

If you have problems or comments...

PBIL Back to PBIL home page