(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0179

BA000037.VV0179      Location/Qualifiers
FT   CDS             189822..191456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0179"
FT                   /product="putative ubiquinone biosynthesis protein AarF"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92943"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92943"
FT                   /db_xref="GOA:Q7MQ31"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ31"
FT                   /protein_id="BAC92943.1"
FT                   /translation="MTPTELKRLYRIIKVQLEYGLDDLLPDHQLAKAPRWMRKSLFWLK
FT                   NQHPEKPLGDRLRLALQELGPVWIKFGQMLSTRRDLFPPHIADPLALLQDQVSPFDGAL
FT                   AKAQMEQALGGPLETWFSDFDLVPLASASIAQVHTAKLKTTNQEVVLKVIRPDIRPIID
FT                   ADLKLMRRMASIVAKAMPEARRLKPIEVVREYEKTLLDELDLRREAANAIQLRRNFTDS
FT                   EELYVPEVYPDFSNETVMVSERIYGIQVSDITGLKANGTNMKLLAERGVSVFFTQVFRD
FT                   SFFHADMHPGNVFVNPEHPENPQWIGLDCGIVGTLNSEDKRYLAENFLAFFNRDYRRVA
FT                   ELHVDSGWVPADTNIDEFEFAIRIVCEPIFAKPLCEISFGHVLLNLFNTARRFNMEVQP
FT                   QLVLLQKTLLYVEGLGRQLYPQLDLWETAKPFLEEWMMNQVGPKALINAIKDRAPYWAE
FT                   KLPELPELLYDSLKQGKAMNQRMDQLYQGYRASKRQQATGKFLFGVGATLVVCSAILVD
FT                   HTYEQLSLATAIAGVTFWLFSWRAYRR"
     MTPTELKRLY RIIKVQLEYG LDDLLPDHQL AKAPRWMRKS LFWLKNQHPE KPLGDRLRLA        60
     LQELGPVWIK FGQMLSTRRD LFPPHIADPL ALLQDQVSPF DGALAKAQME QALGGPLETW       120
     FSDFDLVPLA SASIAQVHTA KLKTTNQEVV LKVIRPDIRP IIDADLKLMR RMASIVAKAM       180
     PEARRLKPIE VVREYEKTLL DELDLRREAA NAIQLRRNFT DSEELYVPEV YPDFSNETVM       240
     VSERIYGIQV SDITGLKANG TNMKLLAERG VSVFFTQVFR DSFFHADMHP GNVFVNPEHP       300
     ENPQWIGLDC GIVGTLNSED KRYLAENFLA FFNRDYRRVA ELHVDSGWVP ADTNIDEFEF       360
     AIRIVCEPIF AKPLCEISFG HVLLNLFNTA RRFNMEVQPQ LVLLQKTLLY VEGLGRQLYP       420
     QLDLWETAKP FLEEWMMNQV GPKALINAIK DRAPYWAEKL PELPELLYDS LKQGKAMNQR       480
     MDQLYQGYRA SKRQQATGKF LFGVGATLVV CSAILVDHTY EQLSLATAIA GVTFWLFSWR       540
     AYRR                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page