(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0183

BA000037.VV0183      Location/Qualifiers
FT   CDS             complement(192992..193150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92947"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92947"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ27"
FT                   /protein_id="BAC92947.1"
FT                   /translation="MISATKIITKVRSYMCNHSIHLQRHHRSFWQKIIGIKEIYICQNC
FT                   GHTIKVR"
     MISATKIITK VRSYMCNHSI HLQRHHRSFW QKIIGIKEIY ICQNCGHTIK VR                52
//

If you have problems or comments...

PBIL Back to PBIL home page