(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0189

BA000037.VV0189      Location/Qualifiers
FT   CDS             201669..202475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0189"
FT                   /product="methyltransferase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92954"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92954"
FT                   /db_xref="GOA:Q7MQ20"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ20"
FT                   /protein_id="BAC92954.1"
FT                   /translation="MQHSFGHSVAVRKATAWLSLFLFWPFFYEIGDYLPVGSPIWGDFL
FT                   VCFASLFEEVRMHTCPLCQHDQILHYFTDKRREYLQCARCELVFVHPEQRLDAKTEKSH
FT                   YDLHENNPLDLGYRRFLSRITDPLLERIAPQSNGLDFGCGPGPTLSLMLEEHGHVMSLY
FT                   DLYYHPDRSVLRREYDFMTATEVIEHLYEPNVVWQQWLNLVKPRGWIGLMTKMVIDREA
FT                   FANWHYKNDPTHVIFFSQATFQYLAERDKLELEFIGKDVILLRKTQ"
     MQHSFGHSVA VRKATAWLSL FLFWPFFYEI GDYLPVGSPI WGDFLVCFAS LFEEVRMHTC        60
     PLCQHDQILH YFTDKRREYL QCARCELVFV HPEQRLDAKT EKSHYDLHEN NPLDLGYRRF       120
     LSRITDPLLE RIAPQSNGLD FGCGPGPTLS LMLEEHGHVM SLYDLYYHPD RSVLRREYDF       180
     MTATEVIEHL YEPNVVWQQW LNLVKPRGWI GLMTKMVIDR EAFANWHYKN DPTHVIFFSQ       240
     ATFQYLAERD KLELEFIGKD VILLRKTQ                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page