(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0191

BA000037.VV0191      Location/Qualifiers
FT   CDS             202475..203020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92955"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92955"
FT                   /db_xref="GOA:Q7MQ19"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ19"
FT                   /protein_id="BAC92955.1"
FT                   /translation="MSRKKKSRKPGAAGAPEFMVTRNRSESDVAGRLRKKDKKRKGLKA
FT                   GGRNSEEGAQQKHGSSQVRDPRLGSKKKIPLIVEPAKKLTKQERRLSAEQELEMLENDA
FT                   KLNVLLDRIESGENLGRGLQQYVDEKLDRIEQLMSQLGLLEPEAEEEFEDEAPVRKSRS
FT                   DDDLLADFEDFDMDDYKG"
     MSRKKKSRKP GAAGAPEFMV TRNRSESDVA GRLRKKDKKR KGLKAGGRNS EEGAQQKHGS        60
     SQVRDPRLGS KKKIPLIVEP AKKLTKQERR LSAEQELEML ENDAKLNVLL DRIESGENLG       120
     RGLQQYVDEK LDRIEQLMSQ LGLLEPEAEE EFEDEAPVRK SRSDDDLLAD FEDFDMDDYK       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page