(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0196

BA000037.VV0196      Location/Qualifiers
FT   CDS             complement(207781..209190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0196"
FT                   /product="nitrogen regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92960"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92960"
FT                   /db_xref="GOA:Q7MQ14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ14"
FT                   /protein_id="BAC92960.1"
FT                   /translation="MSKGYVWVVDDDSSIRWVMEKTLSSANIKCETYANGESVLMALER
FT                   EVPDVLVSDIRMPGIDGIELLRQVHEKCPNLPVIIMTAHSDLDAAVNAYQKGAFEYLPK
FT                   PFDIDETLTLVERAIAHGQEQKREQMASAQTHTAHTPEIIGEAPAMQEVFRAIGRLSRS
FT                   SISVLINGESGTGKELVAHALHRHSPRSSKPFIALNMAAIPKDLIESELFGHEKGAFTG
FT                   ANSVRQGRFEQANGGTLFLDEIGDMPLDIQTRLLRVLADGQFYRVGGHSPIKVDVRIVA
FT                   ATHQNLERLVQQGKFREDLFHRLNVIRVQIPALRERKQDIEKLTQHFLLRAAEELGVEA
FT                   KTLHGSTVEILNRLNWPGNVRQLENICRWLTVMASGSEVLPSDLPSELVNEKRVVDDNN
FT                   ASGTWQETLSNWAEHALESGEKELLAYALPQFERILLEAALKHTNGHKQDAAKVLGWGR
FT                   NTLTRKLKELY"
     MSKGYVWVVD DDSSIRWVME KTLSSANIKC ETYANGESVL MALEREVPDV LVSDIRMPGI        60
     DGIELLRQVH EKCPNLPVII MTAHSDLDAA VNAYQKGAFE YLPKPFDIDE TLTLVERAIA       120
     HGQEQKREQM ASAQTHTAHT PEIIGEAPAM QEVFRAIGRL SRSSISVLIN GESGTGKELV       180
     AHALHRHSPR SSKPFIALNM AAIPKDLIES ELFGHEKGAF TGANSVRQGR FEQANGGTLF       240
     LDEIGDMPLD IQTRLLRVLA DGQFYRVGGH SPIKVDVRIV AATHQNLERL VQQGKFREDL       300
     FHRLNVIRVQ IPALRERKQD IEKLTQHFLL RAAEELGVEA KTLHGSTVEI LNRLNWPGNV       360
     RQLENICRWL TVMASGSEVL PSDLPSELVN EKRVVDDNNA SGTWQETLSN WAEHALESGE       420
     KELLAYALPQ FERILLEAAL KHTNGHKQDA AKVLGWGRNT LTRKLKELY                   469
//

If you have problems or comments...

PBIL Back to PBIL home page