(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0198

BA000037.VV0198      Location/Qualifiers
FT   CDS             complement(210390..210926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92962"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92962"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ12"
FT                   /protein_id="BAC92962.1"
FT                   /translation="MKLLFALVLSLSAPLVCAQTVYTWVDDNGVLHMSDTPNNGAKTVK
FT                   LPDLEASAPPPQVESTQSLDKPAELTKEKPKSQQQEAVPLALTLASPSHDATIRSNQGI
FT                   ITIQVQTNRKLDIGEQLQLVFDGNRYGAPQTSTLWQLKNIDRGTHIIAIQAVRSGKLIA
FT                   STSPISVHLHRTKIK"
     MKLLFALVLS LSAPLVCAQT VYTWVDDNGV LHMSDTPNNG AKTVKLPDLE ASAPPPQVES        60
     TQSLDKPAEL TKEKPKSQQQ EAVPLALTLA SPSHDATIRS NQGIITIQVQ TNRKLDIGEQ       120
     LQLVFDGNRY GAPQTSTLWQ LKNIDRGTHI IAIQAVRSGK LIASTSPISV HLHRTKIK         178
//

If you have problems or comments...

PBIL Back to PBIL home page