(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0200

BA000037.VV0200      Location/Qualifiers
FT   CDS             213064..214893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0200"
FT                   /product="GTP-binding protein TypA"
FT                   /note="involved in stress response"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92964"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92964"
FT                   /db_xref="GOA:Q7MQ10"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ10"
FT                   /protein_id="BAC92964.1"
FT                   /translation="MTTPQIDKLRNIAIIAHVDHGKTTLVDKLLQQSGTLQSRGDVEER
FT                   VMDSNDIEKERGITILAKNTAIRWNDYRINIVDTPGHADFGGEVERIMSMVDCVLLIVD
FT                   AVDGPMPQTRFVTQKAFAHGLKPIVVINKIDRPGARPDWVMDQVFDLFDNLGATDEQLD
FT                   FKVVYASALNGWASLEEGETGEDMEPLFQTIVDVVDAPNVDLDGPLQMQISQLDYSSYV
FT                   GVIGVGRVTRGKVKANQQVTIVGADGKTRNGKVGTVLGYMGLERHEVEQATAGDIIAIT
FT                   GLGELKISDTICDVNKPEALPALSVDEPTVTMTFQVNTSPFAGLEGKYVTSRNILERLE
FT                   KELVHNVALRVEQTEDPDKFRVSGRGELHLSILIENMRREGFELAVSRPEVILKEENGQ
FT                   LMEPFETVTIDVQEEHQGGIMEKIGMRKGELKDMSPDGKGRVRLDFMMPSRGLIGFQTE
FT                   FMTLTSGSGLLYHTFDHYGPHKGGNIGQRINGVLIANAAGKALTNALFNLQERGRLFIG
FT                   HGVEVYEGMVIGIHSRDNDLTVNALKGKQLTNVRASGTDDAQVLTPPITMTLEQALEFI
FT                   DDDELVEVTPENIRIRKKFLTESDRKRASREAK"
     MTTPQIDKLR NIAIIAHVDH GKTTLVDKLL QQSGTLQSRG DVEERVMDSN DIEKERGITI        60
     LAKNTAIRWN DYRINIVDTP GHADFGGEVE RIMSMVDCVL LIVDAVDGPM PQTRFVTQKA       120
     FAHGLKPIVV INKIDRPGAR PDWVMDQVFD LFDNLGATDE QLDFKVVYAS ALNGWASLEE       180
     GETGEDMEPL FQTIVDVVDA PNVDLDGPLQ MQISQLDYSS YVGVIGVGRV TRGKVKANQQ       240
     VTIVGADGKT RNGKVGTVLG YMGLERHEVE QATAGDIIAI TGLGELKISD TICDVNKPEA       300
     LPALSVDEPT VTMTFQVNTS PFAGLEGKYV TSRNILERLE KELVHNVALR VEQTEDPDKF       360
     RVSGRGELHL SILIENMRRE GFELAVSRPE VILKEENGQL MEPFETVTID VQEEHQGGIM       420
     EKIGMRKGEL KDMSPDGKGR VRLDFMMPSR GLIGFQTEFM TLTSGSGLLY HTFDHYGPHK       480
     GGNIGQRING VLIANAAGKA LTNALFNLQE RGRLFIGHGV EVYEGMVIGI HSRDNDLTVN       540
     ALKGKQLTNV RASGTDDAQV LTPPITMTLE QALEFIDDDE LVEVTPENIR IRKKFLTESD       600
     RKRASREAK                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page