(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0206

BA000037.VV0206      Location/Qualifiers
FT   CDS             complement(218570..220510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92970"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92970"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ04"
FT                   /protein_id="BAC92970.1"
FT                   /translation="MKKALISVALLLIVIALIPISILVSLQTRYASQVFNQLNQFSGLG
FT                   MQAESVHYQYPDHFSFKNVSFTHNEVSYIEQLEIWLSPELYANGRVQIASVLLDGLSLQ
FT                   TGLSRSPKTFIPNTVQIHQLAISNLDYADNQLSARGIKFQVKQPQWQRSDQFIPFGEIQ
FT                   FSAQQLYWQGEAFNQPLLDIDYKPQDSALYGLSLSWRGAKVSGQAEQYPQGWSLVNVTV
FT                   EGLDLSQQQLTSILAKPWDRFGSQITHINSLDILRSSLALEDYRLINFELSSENLTLPF
FT                   SLWQQQQGLISFSAESVQDQHNVWVEPRIKFTLDPNAINVEEASAQWQQGNLLFSGTLK
FT                   PDAIELDQLMVNNVKWAAEQPGEGAWLWQWLENASHVSVERLNIERSQFIQLIHQPYWQ
FT                   LSGLNIDGEKLLLKQEQQLGLWQGKLRATAANASYQDILSSHPLVEMHSDDGLWQLDRL
FT                   FAPLKQGYIEAYGQLQLNSLSKPWQATLNADGLPMGLLLSQLPLPFDLNAISSIDVSAT
FT                   GLGGDWAMFSHSLTGGVHARLHEAYTPFDEGNILPLQVSEISLSMERGKLTLAPIKLQG
FT                   PDIEGTIGGASDLTAPEQGGIRYQVKMGCQQLSGDMMSDEHQRVNQCPEQSQAAQETPQ
FT                   AQTEEAANAAS"
     MKKALISVAL LLIVIALIPI SILVSLQTRY ASQVFNQLNQ FSGLGMQAES VHYQYPDHFS        60
     FKNVSFTHNE VSYIEQLEIW LSPELYANGR VQIASVLLDG LSLQTGLSRS PKTFIPNTVQ       120
     IHQLAISNLD YADNQLSARG IKFQVKQPQW QRSDQFIPFG EIQFSAQQLY WQGEAFNQPL       180
     LDIDYKPQDS ALYGLSLSWR GAKVSGQAEQ YPQGWSLVNV TVEGLDLSQQ QLTSILAKPW       240
     DRFGSQITHI NSLDILRSSL ALEDYRLINF ELSSENLTLP FSLWQQQQGL ISFSAESVQD       300
     QHNVWVEPRI KFTLDPNAIN VEEASAQWQQ GNLLFSGTLK PDAIELDQLM VNNVKWAAEQ       360
     PGEGAWLWQW LENASHVSVE RLNIERSQFI QLIHQPYWQL SGLNIDGEKL LLKQEQQLGL       420
     WQGKLRATAA NASYQDILSS HPLVEMHSDD GLWQLDRLFA PLKQGYIEAY GQLQLNSLSK       480
     PWQATLNADG LPMGLLLSQL PLPFDLNAIS SIDVSATGLG GDWAMFSHSL TGGVHARLHE       540
     AYTPFDEGNI LPLQVSEISL SMERGKLTLA PIKLQGPDIE GTIGGASDLT APEQGGIRYQ       600
     VKMGCQQLSG DMMSDEHQRV NQCPEQSQAA QETPQAQTEE AANAAS                      646
//

If you have problems or comments...

PBIL Back to PBIL home page