(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0212

BA000037.VV0212      Location/Qualifiers
FT   CDS             224117..224257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0212"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92976"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92976"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPZ8"
FT                   /protein_id="BAC92976.1"
FT                   /translation="MRAIIFSRIKKDKSQCVQAKKAKAQNLNSERNRLSETIRAECRIG
FT                   Q"
     MRAIIFSRIK KDKSQCVQAK KAKAQNLNSE RNRLSETIRA ECRIGQ                       46
//

If you have problems or comments...

PBIL Back to PBIL home page