(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0227

BA000037.VV0227      Location/Qualifiers
FT   CDS             complement(237174..237857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0227"
FT                   /product="thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92991"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92991"
FT                   /db_xref="GOA:Q7MPY4"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPY4"
FT                   /protein_id="BAC92991.1"
FT                   /translation="MRSKACFLIKTLDPFVIRSKMASITYKFTRVFVVSNITITEAAQT
FT                   HFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELS
FT                   LPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGG
FT                   HVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRG
FT                   DHSYY"
     MRSKACFLIK TLDPFVIRSK MASITYKFTR VFVVSNITIT EAAQTHFANL LGQQPDGTNI        60
     RVFVVNPGTQ NAECGVSYCP PEAVEATDTE IPYQSFSAYV DELSLPFLED AEIDYVTDKM       120
     GSQLTLKAPN AKMRKVADDA PLLERVEYAI QTQVNPQLAG HGGHVKLMEI TDAGVAIVAF       180
     GGGCNGCSMV DVTLKEGIEK ELLQQFSGEL TAVRDATEHD RGDHSYY                     227
//

If you have problems or comments...

PBIL Back to PBIL home page