(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0257

BA000037.VV0257      Location/Qualifiers
FT   CDS             268628..269011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93021"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93021"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV5"
FT                   /protein_id="BAC93021.1"
FT                   /translation="MMLRKGTANLLLLLSLLMALLLSSGFARAQTEPPSNLHHKTSNDI
FT                   TNVSYCDWSLEAVEKDEPGCCEPGGRCYQNQCCTHYGHSMGAAVIESQQYTDEAPYRNE
FT                   WIASPIVIYTSAEMRTHYRPPIA"
     MMLRKGTANL LLLLSLLMAL LLSSGFARAQ TEPPSNLHHK TSNDITNVSY CDWSLEAVEK        60
     DEPGCCEPGG RCYQNQCCTH YGHSMGAAVI ESQQYTDEAP YRNEWIASPI VIYTSAEMRT       120
     HYRPPIA                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page