(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0258

BA000037.VV0258      Location/Qualifiers
FT   CDS             269057..270097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0258"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93022"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93022"
FT                   /db_xref="GOA:Q7MPV4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV4"
FT                   /protein_id="BAC93022.1"
FT                   /translation="MPCELVMRVNRLLFAPPSYRNSKMKTHRFTFAESLPALLFLSVCL
FT                   IWGTTWFAMEIAVQTIPPIFATGLRFLIAAPLLLILGQRLRQPLFFPKGKMHWMFIVAI
FT                   FYFAIPFTLMIFGEQYISSGLASIIFATMPIAVMITSRWFLGLTLRRLQTAGLLIAVLS
FT                   LVLILAKEMSLGGDDYLLGFLALGGAVAIHAVMYVCVQKYCQDIPVLTYNALPSLMASM
FT                   LLLTASWIIEKPAFSVFSQVSMLSVVYLGVFASVGGIVAYFKLGQVSTPFTASICFLFF
FT                   PLIALSLSTWMSGNSISSTSVVLLLPLLGGIFVTKAEPQFWARFGRKRIKSKPVLCKRC
FT                   MKELNV"
     MPCELVMRVN RLLFAPPSYR NSKMKTHRFT FAESLPALLF LSVCLIWGTT WFAMEIAVQT        60
     IPPIFATGLR FLIAAPLLLI LGQRLRQPLF FPKGKMHWMF IVAIFYFAIP FTLMIFGEQY       120
     ISSGLASIIF ATMPIAVMIT SRWFLGLTLR RLQTAGLLIA VLSLVLILAK EMSLGGDDYL       180
     LGFLALGGAV AIHAVMYVCV QKYCQDIPVL TYNALPSLMA SMLLLTASWI IEKPAFSVFS       240
     QVSMLSVVYL GVFASVGGIV AYFKLGQVST PFTASICFLF FPLIALSLST WMSGNSISST       300
     SVVLLLPLLG GIFVTKAEPQ FWARFGRKRI KSKPVLCKRC MKELNV                      346
//

If you have problems or comments...

PBIL Back to PBIL home page