(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0260

BA000037.VV0260      Location/Qualifiers
FT   CDS             270370..270498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0260"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93024"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93024"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV2"
FT                   /protein_id="BAC93024.1"
FT                   /translation="MKGFIEHDFRQHSFAIFSLVLHDSNESAESSLSLKWTLWCPF"
     MKGFIEHDFR QHSFAIFSLV LHDSNESAES SLSLKWTLWC PF                           42
//

If you have problems or comments...

PBIL Back to PBIL home page