(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0262

BA000037.VV0262      Location/Qualifiers
FT   CDS             272326..272583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93026"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93026"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV0"
FT                   /protein_id="BAC93026.1"
FT                   /translation="MRKQTMNPTTQSPTNSVHPARQQRILRLPEVKAKTGFGRSTIYAL
FT                   MASGEFPRSIRIGARAVGWLESDIDQWIETRRIGAAYGRG"
     MRKQTMNPTT QSPTNSVHPA RQQRILRLPE VKAKTGFGRS TIYALMASGE FPRSIRIGAR        60
     AVGWLESDID QWIETRRIGA AYGRG                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page