(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0266

BA000037.VV0266      Location/Qualifiers
FT   CDS             277154..278746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0266"
FT                   /product="type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93030"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93030"
FT                   /db_xref="GOA:Q7MPU6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="PDB:3UFB"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPU6"
FT                   /protein_id="BAC93030.1"
FT                   /translation="MTIRFMARTKKADQPMTTAQQLGAIVKSSRQIMRKDKGLNGDLDR
FT                   LPMLTWIMFLKFLDDLEQMRETEAVLEGKSFQPAIEAPYRWRDWAAIEGGITGDELIAF
FT                   INNDEAMRPDGTRGIGLFAYLRSLQGDNGGDRRDVIATVFKGMQNRMINGYLLRDVVDK
FT                   INGIHFNSSEEMHTLSRLYETMLREMRDAAGDSGEFYTPRPVVRFMVEVMDPQLGESVL
FT                   DPACGTGGFLVEAFEHLERQCKTVEDREVLQESSIFGGEAKSLPYLLVQMNLLLHGLEY
FT                   PRIDPENSLRFPLREMGDKDRVDVILTNPPFGGEEEKGILGNFPEDMQTAETAMLFLQL
FT                   IMRKLKRPGHGSDNGGRAAVVVPNGTLFSDGISARIKEELLKNFNLHTIVRLPEGVFAP
FT                   YTDIAGNLLFFDRSGPTDDIWYYQITVPEGRKKYTKTKPMESHEFDECLNWWSNRIVNQ
FT                   NAWKESASEIIKYSESGQLIDVNLDRKNPNSLEVLEHEEPMDLIEKITTKEESLLAILE
FT                   QIKAEISTQGISK"
     MTIRFMARTK KADQPMTTAQ QLGAIVKSSR QIMRKDKGLN GDLDRLPMLT WIMFLKFLDD        60
     LEQMRETEAV LEGKSFQPAI EAPYRWRDWA AIEGGITGDE LIAFINNDEA MRPDGTRGIG       120
     LFAYLRSLQG DNGGDRRDVI ATVFKGMQNR MINGYLLRDV VDKINGIHFN SSEEMHTLSR       180
     LYETMLREMR DAAGDSGEFY TPRPVVRFMV EVMDPQLGES VLDPACGTGG FLVEAFEHLE       240
     RQCKTVEDRE VLQESSIFGG EAKSLPYLLV QMNLLLHGLE YPRIDPENSL RFPLREMGDK       300
     DRVDVILTNP PFGGEEEKGI LGNFPEDMQT AETAMLFLQL IMRKLKRPGH GSDNGGRAAV       360
     VVPNGTLFSD GISARIKEEL LKNFNLHTIV RLPEGVFAPY TDIAGNLLFF DRSGPTDDIW       420
     YYQITVPEGR KKYTKTKPME SHEFDECLNW WSNRIVNQNA WKESASEIIK YSESGQLIDV       480
     NLDRKNPNSL EVLEHEEPMD LIEKITTKEE SLLAILEQIK AEISTQGISK                  530
//

If you have problems or comments...

PBIL Back to PBIL home page