(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0267

BA000037.VV0267      Location/Qualifiers
FT   CDS             278743..279885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0267"
FT                   /product="type I restriction-modification enzyme,
FT                   specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93031"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93031"
FT                   /db_xref="GOA:Q7MPU5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPU5"
FT                   /protein_id="BAC93031.1"
FT                   /translation="MKEYTLRDVLIRQKEAITVEDDAEYKRITIKMNGNGVLLRDEVIG
FT                   DAIGTKRQFLVSSDQFVLSKIDARNGAFGIVPKSCDGAIITGNFWAFDVNSELADVKYL
FT                   DFMSKTPEFKDFCIVASEGTTNRKYLDENKFLDKRILLPELAEQKKVVAKILKFKNKIE
FT                   LARKIRNEILSDLYVLLNSTFHKLIEGAVYKPMSKVAPLERRKVEIDVNAEYPELGVRC
FT                   FGNGTFHKPILNGMDVGTKKLYQMVPGDLVFSNVFAWEGAIAVVKKEDEGRVGSHRFIT
FT                   CLPKSGVVTADFLCFYFLTTEGLEKIQAASPGGAGRNRTLGLKKLENIEVPVPDYDKQL
FT                   WFNQLQSYVEKIKQAQSENATELEALMPSILDKAFKGELV"
     MKEYTLRDVL IRQKEAITVE DDAEYKRITI KMNGNGVLLR DEVIGDAIGT KRQFLVSSDQ        60
     FVLSKIDARN GAFGIVPKSC DGAIITGNFW AFDVNSELAD VKYLDFMSKT PEFKDFCIVA       120
     SEGTTNRKYL DENKFLDKRI LLPELAEQKK VVAKILKFKN KIELARKIRN EILSDLYVLL       180
     NSTFHKLIEG AVYKPMSKVA PLERRKVEID VNAEYPELGV RCFGNGTFHK PILNGMDVGT       240
     KKLYQMVPGD LVFSNVFAWE GAIAVVKKED EGRVGSHRFI TCLPKSGVVT ADFLCFYFLT       300
     TEGLEKIQAA SPGGAGRNRT LGLKKLENIE VPVPDYDKQL WFNQLQSYVE KIKQAQSENA       360
     TELEALMPSI LDKAFKGELV                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page