(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0273

BA000037.VV0273      Location/Qualifiers
FT   CDS             285564..286616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0273"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93037"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93037"
FT                   /db_xref="GOA:Q7MPT9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPT9"
FT                   /protein_id="BAC93037.1"
FT                   /translation="MIGERIKRARAAAGLSMQALGEQVGISANMVKKYEHDQSMPSSGV
FT                   LLKLATALSVRTEYFFRPAQVTLGEVEYRKKASASAKLLKKIESDVVDQAERWLALKNV
FT                   WPNFPIASFNYHPDVPVVSTLDAVEQVAAKVRTDWQLGMNPLPDLIDLLESKGILVIVS
FT                   NVPQADKFDGLQAKISGQPIVVVSSHWPGCRQRFTLAHELGHLVLHGLLDESLDEEMAC
FT                   NRFASAFLLPEVGLFQHLGERRSNVDPKELYFLKHEYGLSMAACLYRSADLGVITEEKK
FT                   RQIFIQFSKNGWRKQEPGNPYPQEQTLLFEQLVYRALAEGIVSESKAAELLQMSVMALH
FT                   KQRQMLAEAV"
     MIGERIKRAR AAAGLSMQAL GEQVGISANM VKKYEHDQSM PSSGVLLKLA TALSVRTEYF        60
     FRPAQVTLGE VEYRKKASAS AKLLKKIESD VVDQAERWLA LKNVWPNFPI ASFNYHPDVP       120
     VVSTLDAVEQ VAAKVRTDWQ LGMNPLPDLI DLLESKGILV IVSNVPQADK FDGLQAKISG       180
     QPIVVVSSHW PGCRQRFTLA HELGHLVLHG LLDESLDEEM ACNRFASAFL LPEVGLFQHL       240
     GERRSNVDPK ELYFLKHEYG LSMAACLYRS ADLGVITEEK KRQIFIQFSK NGWRKQEPGN       300
     PYPQEQTLLF EQLVYRALAE GIVSESKAAE LLQMSVMALH KQRQMLAEAV                  350
//

If you have problems or comments...

PBIL Back to PBIL home page